RetrogeneDB ID: | retro_cjac_1307 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 14:88693741..88693951(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SLIRP | ||
Ensembl ID: | ENSCJAG00000016946 | ||
Aliases: | None | ||
Description: | SRA stem-loop interacting RNA binding protein [Source:HGNC Symbol;Acc:20495] |
Percent Identity: | 62.5 % |
Parental protein coverage: | 66.67 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | EHFAQFGHIKRCIVPFDKETGFHRGMGWVQFSSEEELQNALQQENHIIDGVKLQVQAQRPKILQIPDEEK |
EHFAQFGH...CI.PFDKETG.HRG.GWV..............ENHII.GVKLQVQAQRPK.LQ.....K | |
Retrocopy | EHFAQFGHL*NCILPFDKETGYHRGLGWVRLLQKKNFR--MH*ENHIIVGVKLQVQAQRPKGLQTSGD*K |
Parental | DF |
DF | |
Retrocopy | DF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 7 .65 RPM |
SRP051959_heart | 0 .00 RPM | 16 .87 RPM |
SRP051959_kidney | 0 .00 RPM | 12 .96 RPM |
SRP051959_liver | 0 .00 RPM | 12 .50 RPM |
SRP051959_lung | 0 .03 RPM | 10 .22 RPM |
SRP051959_lymph_node | 0 .02 RPM | 9 .61 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 18 .76 RPM |
SRP051959_spleen | 0 .00 RPM | 9 .75 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
Homo sapiens | ENSG00000119705 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |