RetrogeneDB ID: | retro_pabe_3712 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | X:147714139..147714453(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SLIRP | ||
Ensembl ID: | ENSPPYG00000006030 | ||
Aliases: | None | ||
Description: | SRA stem-loop interacting RNA binding protein [Source:HGNC Symbol;Acc:20495] |
Percent Identity: | 68.22 % |
Parental protein coverage: | 97.25 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAASAARGAAALRKNINQPVAFVRRIPWTVASSQLK-EHFAQFGHVRRCMLPFDKETGFHRGLAWIQFSS |
MAA.A..GA..L...I..PVAFV..IPWT.AS.QL....FAQFGH...C..PFDKETGFHRGL.W.QFSS | |
Retrocopy | MAALAGKGAMVLHTSISRPVAFVSKIPWTAASNQLM<DGFAQFGHIQKCIVPFDKETGFHRGLGWVQFSS |
Parental | EEGLQNALQRENHIIDGVKVQVCTQRPKLLQTSDDEK |
EE.LQNAL..ENHIIDGVK.QV..QRPK.L.TSD.EK | |
Retrocopy | EE-LQNAL*QENHIIDGVKLQVGAQRPKVL*TSDEEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 11 .72 RPM |
SRP007412_cerebellum | 0 .00 RPM | 18 .85 RPM |
SRP007412_heart | 0 .00 RPM | 24 .84 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .81 RPM |
SRP007412_liver | 0 .00 RPM | 15 .85 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4769 |
Pan troglodytes | retro_ptro_3176 |
Gorilla gorilla | retro_ggor_2972 |
Macaca mulatta | retro_mmul_2544 |
Callithrix jacchus | retro_cjac_4132 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
Homo sapiens | ENSG00000119705 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006030 | 1 retrocopy |
retro_pabe_3712 ,
|
Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |