RetrogeneDB ID: | retro_ptro_3176 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | X:148536418..148536739(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SLIRP | ||
Ensembl ID: | ENSPTRG00000030691 | ||
Aliases: | None | ||
Description: | Chromosome 14 open reading frame 156 [Source:UniProtKB/TrEMBL;Acc:K7BR91] |
Percent Identity: | 69.09 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEH-FAQFGHVRRCILPFDKETGFHRGLGWVQF-S |
MAA.A..G...L..SI..PVAFV..IPWTAAS.QL....FAQFGH...C..PFDKETGFHRGLGWVQF.S | |
Retrocopy | MAALAWKGVMVLHTSISRPVAFVSKIPWTAASNQLMVS<FAQFGHIQKCVVPFDKETGFHRGLGWVQF>S |
Parental | SEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKDF |
SEE.L.NAL.QENHIIDGVK.QV...RPK...TSD.EKDF | |
Retrocopy | SEE-LQNAL*QENHIIDGVKLQVGAQRPKVL*TSDEEKDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .10 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .93 RPM |
SRP007412_heart | 0 .00 RPM | 32 .56 RPM |
SRP007412_kidney | 0 .00 RPM | 36 .14 RPM |
SRP007412_liver | 0 .03 RPM | 17 .25 RPM |
SRP007412_testis | 0 .00 RPM | 6 .74 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4769 |
Gorilla gorilla | retro_ggor_2972 |
Pongo abelii | retro_pabe_3712 |
Macaca mulatta | retro_mmul_2544 |
Callithrix jacchus | retro_cjac_4132 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
Homo sapiens | ENSG00000119705 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy |
retro_ptro_3176 ,
|
Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |