RetrogeneDB ID: | retro_btau_528 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 13:48199782..48200010(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | IMMP1L | ||
| Ensembl ID: | ENSBTAG00000000475 | ||
| Aliases: | None | ||
| Description: | mitochondrial inner membrane protease subunit 1 [Source:RefSeq peptide;Acc:NP_001073095] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 67.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVLVCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVV |
| ML..VLGK.F.LV.YTI.YGCIAH.AFEYVG.V..C..PSMEPTIQNSD.VFAE.L.RHFYGIQR.DI.. | |
| Retrocopy | MLCVVLGKMFWLVSYTI*YGCIAHGAFEYVGSVVMCFEPSMEPTIQNSDTVFAESLNRHFYGIQRDDIMI |
| Parental | AKSPSD |
| .KSPSD | |
| Retrocopy | TKSPSD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 5 .91 RPM |
| ERP005899_muscle | 0 .00 RPM | 4 .80 RPM |
| SRP017611_brain | 0 .00 RPM | 3 .47 RPM |
| SRP017611_kidney | 0 .00 RPM | 8 .30 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .42 RPM |
| SRP030211_testis | 0 .00 RPM | 6 .08 RPM |