RetrogeneDB ID: | retro_cfam_819 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 18:15421433..15421646(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSCAFG00000032714 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
| Percent Identity: | 77.46 % |
| Parental protein coverage: | 61.21 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | SGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAK |
| SG.YY.GGFE.KMTK.EA.LILG.SPT.NK.KIRDAHR..ML.NHPD..GSPYIAAKIN.AK..LEGQAK | |
| Retrocopy | SGSYYIGGFESKMTKQEATLILGISPTNNKEKIRDAHR*VML*NHPDRRGSPYIAAKINKAKEFLEGQAK |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 34 .82 RPM |
| SRP017611_brain | 0 .00 RPM | 20 .48 RPM |
| SRP017611_kidney | 0 .00 RPM | 72 .38 RPM |
| SRP017611_liver | 0 .00 RPM | 24 .07 RPM |