RetrogeneDB ID: | retro_pabe_2126 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2b:67418667..67418879(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSPPYG00000014328 | ||
Aliases: | DNAJC19, TIM14, TIMM14 | ||
Description: | Mitochondrial import inner membrane translocase subunit TIM14 [Source:UniProtKB/Swiss-Prot;Acc:Q5RF34] |
Percent Identity: | 73.97 % |
Parental protein coverage: | 62.07 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRI-MLLNH |
.LQA.KH..P.VKQ.FQSLPKSAFSGGY.R.GFEPKMTK.EAA.IL.VS.TA.KGKIRDA...I.M.LNH | |
Retrocopy | ILQARKHT*PEVKQDFQSLPKSAFSGGY*RSGFEPKMTKWEAA-ILPVSLTASKGKIRDAQ*QI<MILNH |
Parental | PDK |
P.K | |
Retrocopy | PKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 8 .79 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .17 RPM |
SRP007412_heart | 0 .00 RPM | 17 .76 RPM |
SRP007412_kidney | 0 .10 RPM | 15 .35 RPM |
SRP007412_liver | 0 .00 RPM | 15 .52 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2349 |
Pan troglodytes | retro_ptro_1719 |
Gorilla gorilla | retro_ggor_1783 |
Macaca mulatta | retro_mmul_946 |