RetrogeneDB ID: | retro_cjac_1084 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 13:37249987..37250248(+) | ||
Located in intron of: | ENSCJAG00000002240 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM133B | ||
Ensembl ID: | ENSCJAG00000013910 | ||
Aliases: | None | ||
Description: | family with sequence similarity 133, member B [Source:HGNC Symbol;Acc:28629] |
Percent Identity: | 81.61 % |
Parental protein coverage: | 77.48 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFE-EKMNENWKK |
K.DN.VAYMNPIA..RSRGPIQS.GP.IQDYLN.PRP.WEEV.EQLEKKKK.S..LAEFE..KMNENWKK | |
Retrocopy | KWDNHVAYMNPIAVTRSRGPIQSLGPKIQDYLN*PRPLWEEVIEQLEKKKKDSQVLAEFEKKKMNENWKK |
Parental | ELEKHREKLLSGSESSS |
ELEKH.EKLLSGSES.S | |
Retrocopy | ELEKHEEKLLSGSESLS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 7 .06 RPM |
SRP051959_heart | 0 .00 RPM | 7 .23 RPM |
SRP051959_kidney | 0 .00 RPM | 9 .54 RPM |
SRP051959_liver | 0 .00 RPM | 5 .98 RPM |
SRP051959_lung | 0 .00 RPM | 9 .39 RPM |
SRP051959_lymph_node | 0 .00 RPM | 12 .19 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 5 .28 RPM |
SRP051959_spleen | 0 .00 RPM | 12 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000007438 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013910 | 3 retrocopies |
retro_cjac_1084 , retro_cjac_1163, retro_cjac_4095,
|
Equus caballus | ENSECAG00000026810 | 1 retrocopy | |
Homo sapiens | ENSG00000234545 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000029755 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000005933 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019802 | 4 retrocopies | |
Mus musculus | ENSMUSG00000058503 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000015333 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025825 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000009163 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000015317 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028195 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011674 | 1 retrocopy |