RetrogeneDB ID: | retro_cjac_1163 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 13:73930225..73930540(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM133B | ||
Ensembl ID: | ENSCJAG00000013910 | ||
Aliases: | None | ||
Description: | family with sequence similarity 133, member B [Source:HGNC Symbol;Acc:28629] |
Percent Identity: | 97.14 % |
Parental protein coverage: | 94.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWK |
MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLN.PRPTWEEVKEQLEKKKKG.KALAEFEEKMNENWK | |
Retrocopy | MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLN*PRPTWEEVKEQLEKKKKGYKALAEFEEKMNENWK |
Parental | KELEKHREKLLSGSESSSKKRQRKKKEKKKSGRVS |
KELEKHREKLLSGSESSSKKRQRKKKEKKKSGR.S | |
Retrocopy | KELEKHREKLLSGSESSSKKRQRKKKEKKKSGRYS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .29 RPM | 7 .06 RPM |
SRP051959_heart | 0 .26 RPM | 7 .23 RPM |
SRP051959_kidney | 0 .44 RPM | 9 .54 RPM |
SRP051959_liver | 0 .39 RPM | 5 .98 RPM |
SRP051959_lung | 0 .49 RPM | 9 .39 RPM |
SRP051959_lymph_node | 0 .34 RPM | 12 .19 RPM |
SRP051959_skeletal_muscle | 0 .13 RPM | 5 .28 RPM |
SRP051959_spleen | 0 .50 RPM | 12 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000007438 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013910 | 3 retrocopies |
retro_cjac_1084, retro_cjac_1163 , retro_cjac_4095,
|
Equus caballus | ENSECAG00000026810 | 1 retrocopy | |
Homo sapiens | ENSG00000234545 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000029755 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000005933 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019802 | 4 retrocopies | |
Mus musculus | ENSMUSG00000058503 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000015333 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025825 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000009163 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000015317 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028195 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011674 | 1 retrocopy |