RetrogeneDB ID: | retro_cjac_4084 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | X:68876381..68876591(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP5 | ||
Ensembl ID: | ENSCJAG00000000444 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 5 (psoriasis-associated) [Source:HGNC Symbol;Acc:3560] |
Percent Identity: | 59.15 % |
Parental protein coverage: | 52.99 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | QFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVDCVINNVTCTRIYEK |
QFSC...EK..ETT...RKTQ....FT..ALVQHQE..GKEST..R..KDG.L...C...NVTCT.IY.K | |
Retrocopy | QFSCKPEEKSKETTDYSRKTQAAYKFTNDALVQHQERGGKESTM-RNVKDGILITECAMYNVTCT*IYKK |
Parental | V |
V | |
Retrocopy | V |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .16 RPM | 4 .68 RPM |
SRP051959_heart | 0 .07 RPM | 17 .70 RPM |
SRP051959_kidney | 0 .18 RPM | 1 .15 RPM |
SRP051959_liver | 0 .06 RPM | 0 .95 RPM |
SRP051959_lung | 0 .26 RPM | 17 .50 RPM |
SRP051959_lymph_node | 0 .23 RPM | 7 .28 RPM |
SRP051959_skeletal_muscle | 0 .11 RPM | 7 .23 RPM |
SRP051959_spleen | 0 .21 RPM | 12 .02 RPM |