RetrogeneDB ID: | retro_cjac_3992 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | GL286665.1:8972..9405(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000004933 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PERP | ||
| Ensembl ID: | ENSCJAG00000019024 | ||
| Aliases: | None | ||
| Description: | PERP, TP53 apoptosis effector [Source:HGNC Symbol;Acc:17637] |
| Percent Identity: | 90.48 % |
| Parental protein coverage: | 75.13 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | PLR-LACERCRWILP-CS-AQRHR-FDIIALAGRGWLQSNDHVQTSSLWWRCFHEGGGSG-YEDGCQSLM |
| PLR.LACERCR.ILP.CS.AQRHR.FDI.ALAGRGWLQSNDHVQTSSLWWRCFHEGGGSG.YEDGCQSLM | |
| Retrocopy | PLR>LACERCRGILP>CS>AQRHR>FDITALAGRGWLQSNDHVQTSSLWWRCFHEGGGSGSYEDGCQSLM |
| Parental | DYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFNL |
| .YAWGRAAAAMLFCGFIILVICFI.SFFAL..PQMLVFLRVIGGLLALAAVFQIISLVIYPV.YTQTF.L | |
| Retrocopy | EYAWGRAAAAMLFCGFIILVICFIFSFFALIRPQMLVFLRVIGGLLALAAVFQIISLVIYPVNYTQTFGL |
| Parental | HANPAIT |
| HANPA.T | |
| Retrocopy | HANPAVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .80 RPM | 68 .76 RPM |
| SRP051959_heart | 0 .70 RPM | 29 .68 RPM |
| SRP051959_kidney | 0 .55 RPM | 22 .96 RPM |
| SRP051959_liver | 0 .41 RPM | 15 .51 RPM |
| SRP051959_lung | 0 .68 RPM | 17 .37 RPM |
| SRP051959_lymph_node | 0 .34 RPM | 1 .76 RPM |
| SRP051959_skeletal_muscle | 0 .52 RPM | 4 .63 RPM |
| SRP051959_spleen | 0 .13 RPM | 2 .44 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020097 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019024 | 1 retrocopy |
retro_cjac_3992 ,
|
| Homo sapiens | ENSG00000112378 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028340 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004872 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013979 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001473 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000997 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014930 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004238 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011669 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017043 | 3 retrocopies |