RetrogeneDB ID: | retro_pabe_2416 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3_random:6097626..6098039(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PERP | ||
Ensembl ID: | ENSPPYG00000017043 | ||
Aliases: | None | ||
Description: | PERP, TP53 apoptosis effector [Source:HGNC Symbol;Acc:17637] |
Percent Identity: | 62.41 % |
Parental protein coverage: | 70.98 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | EGGGSGSYEEGCQSLMEYAWGKTAAAMLFWGFLILV-NLFHPXXLRPLWTPDAR-LLRV-IGGLLALAAV |
..GGS.....GCQSL.EY..GK.AAAMLF.G...LV..LFHP..L.PL.TPDA..LLRV..GGL...AA. | |
Retrocopy | QDGGSRPTQDGCQSLVEYVGGKAAAAMLFCGCIMLV<DLFHPHLLCPLCTPDAS>LLRV>VGGLPTPAAA |
Parental | FQIISLVIYPVKYTQTFALHANPAVT-YIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYF |
.QIISLVI.PVKYT.TF.LHANPAVT..I..W..GF.W..T.ILIGC.F.FCC....ED.LL..AKPRYF | |
Retrocopy | LQIISLVINPVKYTHTFNLHANPAVT>HICHWTCGFRWVDTVILIGCPFSFCCSAKDEDNLL*GAKPRYF |
Parental | Y |
. | |
Retrocopy | H |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .88 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .66 RPM |
SRP007412_heart | 0 .00 RPM | 46 .09 RPM |
SRP007412_kidney | 0 .00 RPM | 30 .73 RPM |
SRP007412_liver | 0 .00 RPM | 16 .80 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000020097 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019024 | 1 retrocopy | |
Homo sapiens | ENSG00000112378 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028340 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004872 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013979 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000001473 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000997 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000014930 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000004238 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011669 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017043 | 3 retrocopies |
retro_pabe_1267, retro_pabe_2400, retro_pabe_2416 ,
|