RetrogeneDB ID: | retro_dnov_2648 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_94081:5315..5667(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRSF9 | ||
| Ensembl ID: | ENSDNOG00000012598 | ||
| Aliases: | None | ||
| Description: | serine/arginine-rich splicing factor 9 [Source:HGNC Symbol;Acc:10791] |
| Percent Identity: | 64.57 % |
| Parental protein coverage: | 55.2 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 5 |
| Parental | KYGRIREI-ELKNRHGLVPFAFVRFEDPRDAEDAIYGRN-GYDYGQCRLRVEFPRTYGGR-GGWPRGGRN |
| ..GR..EI..LK...GLVP...V..EDPR.AE...YGR..GYDY.Q.RLR.EFPRT.GG..G.WP.GG.N | |
| Retrocopy | RVGRTHEI<QLKPPQGLVPSTSVHLEDPRGAEGTVYGRG<GYDYSQGRLRGEFPRTQGGG<GAWPVGG-N |
| Parental | GPPTRRSD-FRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGMG-MVEYLRKED |
| GPPTR.S..F.VLV.GLPP.GSWQDL..H.RE.GD.CYADVQ.DG.G.MVE.LRKE. | |
| Retrocopy | GPPTRGSG<FQVLVAGLPP*GSWQDL--HLRETGDACYADVQEDGIG<MVE*LRKEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 69 .81 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 40 .97 RPM |
| SRP012922_heart | 0 .00 RPM | 7 .43 RPM |
| SRP012922_kidney | 0 .00 RPM | 58 .32 RPM |
| SRP012922_liver | 0 .00 RPM | 39 .63 RPM |
| SRP012922_lung | 0 .00 RPM | 49 .02 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 4 .50 RPM |
| SRP012922_spleen | 0 .00 RPM | 48 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012792 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000009241 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001187 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000421 | 9 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007821 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000012598 | 2 retrocopies |
retro_dnov_1555, retro_dnov_2648 ,
|
| Homo sapiens | ENSG00000111786 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016494 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015661 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003852 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000004234 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005031 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005685 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009906 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008499 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006848 | 4 retrocopies |