RetrogeneDB ID: | retro_dnov_2328 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_64387:152..425(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRSF3 | ||
| Ensembl ID: | ENSDNOG00000000421 | ||
| Aliases: | None | ||
| Description: | serine/arginine-rich splicing factor 3 [Source:HGNC Symbol;Acc:10785] |
| Percent Identity: | 59.79 % |
| Parental protein coverage: | 58.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNLPGFAFVXXXXXXXAADAVRELDKTL |
| MHRD..PLDCKV.V....N.GN........GYY.PLRSVWVARN.P.F.FV.......AADA..ELD... | |
| Retrocopy | MHRDYYPLDCKVCVD---NLGNNDKTD---GYYVPLRSVWVARNSPSFSFVEFEDLQDAADATGELDRRT |
| Parental | C-GCRVRVELSNGEKRSRNRGPPPSWG |
| C.GC..RVEL.NG.KRSRN.GPPP.WG | |
| Retrocopy | CFGCSERVELLNGKKRSRNGGPPPFWG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 82 .84 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 33 .68 RPM |
| SRP012922_heart | 0 .00 RPM | 20 .65 RPM |
| SRP012922_kidney | 0 .00 RPM | 19 .44 RPM |
| SRP012922_liver | 0 .00 RPM | 28 .79 RPM |
| SRP012922_lung | 0 .00 RPM | 58 .49 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 11 .08 RPM |
| SRP012922_spleen | 0 .00 RPM | 74 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016062 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000421 | 9 retrocopies |
retro_dnov_1326, retro_dnov_1513, retro_dnov_1702, retro_dnov_1951, retro_dnov_2153, retro_dnov_2328 , retro_dnov_2491, retro_dnov_569, retro_dnov_784,
|
| Dasypus novemcinctus | ENSDNOG00000007821 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000012598 | 2 retrocopies | |
| Equus caballus | ENSECAG00000018741 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000017186 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000018193 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010671 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000071172 | 9 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006684 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000000502 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000018106 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000001564 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014280 | 5 retrocopies |