RetrogeneDB ID: | retro_etel_1621 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_283533:7511..7721(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LAMTOR3 | ||
Ensembl ID: | ENSETEG00000009065 | ||
Aliases: | None | ||
Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
Percent Identity: | 57.14 % |
Parental protein coverage: | 56.45 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MADDLKRFLYKKLPXXXXXXXXXXXXXXXXXFIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKS |
.ADDL.RFLY.K.P..................IK.AND.APE.ALRP.FLST.ALA.D.GSKLGLS.NKS | |
Retrocopy | VADDLQRFLYEKAPSVEGHHTIVISDRDGAPVIKAANDDAPEPALRPDFLSTSALAIDRGSKLGLSGNKS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |