RetrogeneDB ID: | retro_rnor_2341 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:5635765..5635953(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lamtor3 | ||
| Ensembl ID: | ENSRNOG00000010552 | ||
| Aliases: | Lamtor3, MP1, Map2k1ip1, Mapksp1 | ||
| Description: | Ragulator complex protein LAMTOR3 [Source:UniProtKB/Swiss-Prot;Acc:Q5U204] |
| Percent Identity: | 70.31 % |
| Parental protein coverage: | 50.81 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MADDLKRFLYKKLPSVEGLHAIVVSDRDGV-PVIKVANDSAPEHALRPGFLSTFALATDQGSKL |
| M.DDLKR.LYKKLPS.EGLHAIVV..R.G.....K..NDSAPEHALRPGFLS.F.LAT.Q...L | |
| Retrocopy | MVDDLKRSLYKKLPSIEGLHAIVVRERQGA<LLLKWLNDSAPEHALRPGFLSAFSLAT*QDNEL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .18 RPM |
| SRP017611_kidney | 0 .00 RPM | 19 .26 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .19 RPM |