RetrogeneDB ID: | retro_etel_217 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | GeneScaffold_3732:266424..266649(+) | ||
| Located in intron of: | ENSETEG00000001346 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSETEG00000003715 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 67.11 % |
| Parental protein coverage: | 85.39 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | RRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAY |
| .RL.YNTASNKTRLSRT.GNR...LYT.KVGKAPKSACG...GRL.GV.A.R..VLM.LSK.K...S.A. | |
| Retrocopy | QRLTYNTASNKTRLSRTHGNRNASLYT-KVGKAPKSACGPFSGRL*GVHAMRSQVLMWLSKAKQMASWAP |
| Parental | GGSMCA |
| ..S.CA | |
| Retrocopy | *ESDCA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |