RetrogeneDB ID: | retro_mmus_3524 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:134681519..134681741(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000082655 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl34 | ||
| Ensembl ID: | ENSMUSG00000062006 | ||
| Aliases: | Rpl34, 1100001I22Rik | ||
| Description: | ribosomal protein L34 [Source:MGI Symbol;Acc:MGI:1915686] |
| Percent Identity: | 90.54 % |
| Parental protein coverage: | 63.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
| MVQ.LTY.RRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGV.A.RPKVL.RLSKT | |
| Retrocopy | MVQCLTYHRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVHAGRPKVLLRLSKT |
| Parental | QKHV |
| .K.V | |
| Retrocopy | KKRV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 41 .14 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 24 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 40 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 42 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 39 .75 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_155258 | 417 libraries | 427 libraries | 222 libraries | 6 libraries | 0 libraries |
