RetrogeneDB ID: | retro_fcat_1713 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | E2:44377348..44377618(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CNEP1R1 | ||
Ensembl ID: | ENSFCAG00000023936 | ||
Aliases: | None | ||
Description: | CTD nuclear envelope phosphatase 1 regulatory subunit 1 [Source:HGNC Symbol;Acc:26759] |
Percent Identity: | 56.84 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPF-FTISCITLIGLFFA-GIHKRVVAPSIIAARCR |
ML...V.VC....AW.WLID...Q..SFFTSLWN.P..FT.SC..L.GLFFA.GI.KR...PSI....C. | |
Retrocopy | MLPMEVPVCM--DAWKWLIDAKMQE-SFFTSLWNNPL>FTMSCFPLMGLFFA<GIPKRIATPSITTGQCQ |
Parental | TVLAEYNMSCDDTGKLILKPRPHVQ |
TVL.E...SC.DTGKL....R.HVQ | |
Retrocopy | TVLTECSTSCGDTGKLTWESRLHVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 22 .84 RPM |
SRP017611_kidney | 0 .00 RPM | 22 .78 RPM |
SRP017611_liver | 0 .00 RPM | 10 .82 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy | |
Felis catus | ENSFCAG00000023936 | 1 retrocopy |
retro_fcat_1713 ,
|
Homo sapiens | ENSG00000205423 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007335 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |