RetrogeneDB ID: | retro_pabe_3799 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | X:102602080..102602425(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNEP1R1 | ||
| Ensembl ID: | ENSPPYG00000007335 | ||
| Aliases: | CNEP1R1, TMEM188 | ||
| Description: | Nuclear envelope phosphatase-regulatory subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5R7J7] |
| Percent Identity: | 89.08 % |
| Parental protein coverage: | 92.8 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | LKAFERRLTEYIHCLQPATG-RWRMLLIVVSVCT-ATGAWNWLIDPETQKVSFFTS-LWNHPFFTISCIT |
| LKAFERRLTEYIHCLQPAT...WRMLL.VVSVCT.ATGAWNWLIDPET.KVSFFTS..WNHPFFTIS.IT | |
| Retrocopy | LKAFERRLTEYIHCLQPATR<MWRMLLLVVSVCT<ATGAWNWLIDPETEKVSFFTS<IWNHPFFTISYIT |
| Parental | LIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ |
| LIGLFFAGIHKRVVAPSIIAA...T.LAEYNMSCDDTGKLILKPRPHVQ | |
| Retrocopy | LIGLFFAGIHKRVVAPSIIAAQRQTILAEYNMSCDDTGKLILKPRPHVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .20 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .07 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .55 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .91 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4886 |
| Pan troglodytes | retro_ptro_3255 |
| Gorilla gorilla | retro_ggor_3051 |
| Macaca mulatta | retro_mmul_2624 |
| Callithrix jacchus | retro_cjac_4204 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
| Homo sapiens | ENSG00000205423 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007335 | 3 retrocopies |
retro_pabe_1396, retro_pabe_2430, retro_pabe_3799 ,
|
| Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |