RetrogeneDB ID: | retro_fcat_368 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A2:17916924..17917149(-) | ||
| Located in intron of: | ENSFCAG00000023457 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSFCAG00000015502 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 64.1 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
| M.Q.L....R.SYNT.SNKT.LS...GNR.VY.YT.K.GKAPKSACG...G.L..V.AVRPKVLMRLSKT | |
| Retrocopy | MIQSLA*HHRPSYNTVSNKTKLS*IHGNRVVYFYTNKTGKAPKSACGT*AG*LQEVCAVRPKVLMRLSKT |
| Parental | KKHVS |
| ..HVS | |
| Retrocopy | ENHVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 56 .47 RPM |
| SRP017611_kidney | 0 .00 RPM | 179 .11 RPM |
| SRP017611_liver | 0 .00 RPM | 84 .61 RPM |