RetrogeneDB ID: | retro_ggor_1224 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 16:4349360..4349597(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DBI | ||
Ensembl ID: | ENSGGOG00000010372 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.76 % |
Parental protein coverage: | 53.85 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | EEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKA--YINKV |
....H.KTKP...EM.F.Y.HYK.A.VG.INTE.P.M.DF.GKAK.D.WN.LKG...ED.MKA..Y.N.V | |
Retrocopy | QDIKHFKTKPAGDEMRFLYSHYKRASVGNINTELPRMVDFKGKAK*DPWN*LKGAAREDPMKAKAYVNRV |
Parental | EELKKKYGI |
EELKKK..I | |
Retrocopy | EELKKKFRI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .17 RPM |
SRP007412_cerebellum | 0 .00 RPM | 82 .26 RPM |
SRP007412_heart | 0 .00 RPM | 53 .82 RPM |
SRP007412_kidney | 0 .00 RPM | 172 .35 RPM |
SRP007412_liver | 0 .00 RPM | 160 .67 RPM |
SRP007412_testis | 0 .00 RPM | 19 .68 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1619 |