RetrogeneDB ID: | retro_pvam_1121 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | scaffold_3088:153031..153202(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DBI | ||
Ensembl ID: | ENSPVAG00000014349 | ||
Aliases: | None | ||
Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
Percent Identity: | 67.8 % |
Parental protein coverage: | 58.42 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | EEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEGAVKAYINKVEEL |
.E.LFI.S.YK..T.GDINT......D.K.K.KWDAWNELKGTSKE.A.KAYI.KVEEL | |
Retrocopy | DEVLFICSYYKILTMGDINTDNDA--DHKCKVKWDAWNELKGTSKEDAMKAYIDKVEEL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |