RetrogeneDB ID: | retro_mmus_2307 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:138495867..138496093(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Dbi | ||
| Ensembl ID: | ENSMUSG00000026385 | ||
| Aliases: | Dbi, ACBD1, Acbp, EP, endozepine | ||
| Description: | diazepam binding inhibitor [Source:MGI Symbol;Acc:MGI:94865] |
| Percent Identity: | 61.04 % |
| Parental protein coverage: | 87.36 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWD-SWNKLKGTSKESAM |
| QAEFD...EEVK.LK..PTDEEM..IYSHF..A...D.NTD.PGL..L.G.AKW...W....G.SK.SAM | |
| Retrocopy | QAEFDQTPEEVKYLKMKPTDEEMPLIYSHFNHA-MNDTNTDLPGLCNLRGEAKWE>GWTQWEGISKLSAM |
| Parental | KTYVEKV |
| KTYV.K. | |
| Retrocopy | KTYVSKI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 66 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 114 .55 RPM |
| SRP007412_heart | 0 .00 RPM | 67 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 222 .26 RPM |
| SRP007412_liver | 0 .00 RPM | 387 .78 RPM |
| SRP007412_testis | 0 .00 RPM | 21 .54 RPM |