RetrogeneDB ID: | retro_mmus_2307 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 3:138495867..138496093(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Dbi | ||
Ensembl ID: | ENSMUSG00000026385 | ||
Aliases: | Dbi, ACBD1, Acbp, EP, endozepine | ||
Description: | diazepam binding inhibitor [Source:MGI Symbol;Acc:MGI:94865] |
Percent Identity: | 61.04 % |
Parental protein coverage: | 87.36 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | QAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWD-SWNKLKGTSKESAM |
QAEFD...EEVK.LK..PTDEEM..IYSHF..A...D.NTD.PGL..L.G.AKW...W....G.SK.SAM | |
Retrocopy | QAEFDQTPEEVKYLKMKPTDEEMPLIYSHFNHA-MNDTNTDLPGLCNLRGEAKWE>GWTQWEGISKLSAM |
Parental | KTYVEKV |
KTYV.K. | |
Retrocopy | KTYVSKI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 66 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 114 .55 RPM |
SRP007412_heart | 0 .00 RPM | 67 .43 RPM |
SRP007412_kidney | 0 .00 RPM | 222 .26 RPM |
SRP007412_liver | 0 .00 RPM | 387 .78 RPM |
SRP007412_testis | 0 .00 RPM | 21 .54 RPM |