RetrogeneDB ID: | retro_ggor_2349 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 6:70423702..70424078(+) | ||
| Located in intron of: | ENSGGOG00000011243 | ||
Retrocopy information | Ensembl ID: | ENSGGOG00000024049 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFAB1 | ||
| Ensembl ID: | ENSGGOG00000006320 | ||
| Aliases: | None | ||
| Description: | Acyl carrier protein, mitochondrial [Source:UniProtKB/TrEMBL;Acc:G3QTY8] |
| Percent Identity: | 60.32 % |
| Parental protein coverage: | 77.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LCSAGTQTRLGT---LQPALVLAQTESRSVTQAGMQWRDLSPLTRQGIVKQILALLK-IHKLDSHKLSVN |
| LCS.GT..RLG....L...L....T....VTQ...Q..DL.PLT..GI....L..LK.....D..KLSVN | |
| Retrocopy | LCSVGTLMRLGLCSWLHSGLWCLRTCWVEVTQSCCQYSDLPPLTLEGIEDCLLYILKPCDRIDPEKLSVN |
| Parental | SHFMKDLGLDSLDQVE-IIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE |
| S.FMKDL.LDSLDQVE...M.MED.FGFEIPDID.EKL.CPQEIVDYIAD..DVYE | |
| Retrocopy | SYFMKDLCLDSLDQVE>VSMVMEDKFGFEIPDIDVEKLICPQEIVDYIADRRDVYE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 19 .47 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 16 .82 RPM |
| SRP007412_heart | 0 .03 RPM | 22 .42 RPM |
| SRP007412_kidney | 0 .00 RPM | 28 .87 RPM |
| SRP007412_liver | 0 .08 RPM | 16 .86 RPM |
| SRP007412_testis | 0 .10 RPM | 12 .54 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3484 |
| Pan troglodytes | retro_ptro_2358 |
| Pongo abelii | retro_pabe_2879 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014304 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017667 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020616 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012038 | 2 retrocopies | |
| Felis catus | ENSFCAG00000013241 | 3 retrocopies | |
| Homo sapiens | ENSG00000004779 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006320 | 1 retrocopy |
retro_ggor_2349 ,
|
| Macropus eugenii | ENSMEUG00000012681 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000007778 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000020522 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016352 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000030869 | 6 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008457 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005562 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007192 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007889 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018129 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024657 | 2 retrocopies |