RetrogeneDB ID: | retro_ggor_3071 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | cutchr:1183464..1183838(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARF1 | ||
Ensembl ID: | ENSGGOG00000011263 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.43 % |
Parental protein coverage: | 69.06 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVF-A |
E..NISFTVWD..GQ.KI.PLW.HYFQNT.GLIF..D..DRE..N.A.EELMRMLAEDEL..AV.LVF.. | |
Retrocopy | ESRNISFTVWDMAGQHKIWPLWCHYFQNT*GLIFMEDGSDREHMNKAHEELMRMLAEDELWNAVPLVF<P |
Parental | NKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
NK..L.N.MN..EITDKLGLHSL.HR.WYIQATC.T.GD.L.EGLDWLS.QL.N.K | |
Retrocopy | NK*ALLNTMNTTEITDKLGLHSLLHRKWYIQATCGTCGDQLHEGLDWLSSQLQN*K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 217 .85 RPM |
SRP007412_cerebellum | 0 .00 RPM | 174 .61 RPM |
SRP007412_heart | 0 .00 RPM | 116 .73 RPM |
SRP007412_kidney | 0 .00 RPM | 196 .80 RPM |
SRP007412_liver | 0 .00 RPM | 170 .85 RPM |
SRP007412_testis | 0 .00 RPM | 303 .65 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016671 | 10 retrocopies | |
Cavia porcellus | ENSCPOG00000021174 | 1 retrocopy | |
Ciona savignyi | ENSCSAVG00000007011 | 1 retrocopy | |
Felis catus | ENSFCAG00000029374 | 1 retrocopy | |
Homo sapiens | ENSG00000143761 | 3 retrocopies | |
Gallus gallus | ENSGALG00000005393 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000000294 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004952 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011263 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000016749 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000019009 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007020 | 6 retrocopies | |
Mus musculus | ENSMUSG00000048076 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000023645 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000002066 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000009218 | 9 retrocopies | |
Tetraodon nigroviridis | ENSTNIG00000011685 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014186 | 2 retrocopies |