RetrogeneDB ID: | retro_ggor_491 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:225838016..225838261(-) | ||
Located in intron of: | ENSGGOG00000010397 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSGGOG00000009120 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.31 % |
Parental protein coverage: | 70.69 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | VAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANK |
VA.GLTI.A..FAG..VLQAMKHM.PQ..QVFQSLPKSAF.GGYYRGGFEPKMT..EAALIL.V.PTANK | |
Retrocopy | VAAGLTIVAVEFAGH*VLQAMKHMQPQAEQVFQSLPKSAFGGGYYRGGFEPKMTRWEAALILHVCPTANK |
Parental | -GKIRDAHRRIML |
.GKI..AHR.IML | |
Retrocopy | <GKIIAAHRQIML |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .97 RPM |
SRP007412_cerebellum | 0 .08 RPM | 7 .05 RPM |
SRP007412_heart | 0 .00 RPM | 12 .98 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .48 RPM |
SRP007412_liver | 0 .00 RPM | 12 .34 RPM |
SRP007412_testis | 0 .00 RPM | 6 .22 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_538 |
Pan troglodytes | retro_ptro_404 |