RetrogeneDB ID: | retro_ggor_1783 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2b:65196842..65197054(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSGGOG00000009120 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.23 % |
| Parental protein coverage: | 62.07 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRI-MLLNH |
| VLQA.KH..P.VKQ.FQSLPKSAFSGGY.RGG.EPK.TK.EAA.IL.VS.TA.KGK.RDA...I.M.LN. | |
| Retrocopy | VLQARKHI*PEVKQDFQSLPKSAFSGGY*RGGLEPKRTKWEAA-ILPVSLTAIKGKVRDAQ*QI<MILNR |
| Parental | PDK |
| P.K | |
| Retrocopy | PKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 9 .97 RPM |
| SRP007412_cerebellum | 0 .20 RPM | 7 .05 RPM |
| SRP007412_heart | 0 .06 RPM | 12 .98 RPM |
| SRP007412_kidney | 0 .20 RPM | 16 .48 RPM |
| SRP007412_liver | 0 .08 RPM | 12 .34 RPM |
| SRP007412_testis | 0 .52 RPM | 6 .22 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2349 |
| Pan troglodytes | retro_ptro_1719 |
| Pongo abelii | retro_pabe_2126 |
| Macaca mulatta | retro_mmul_946 |