RetrogeneDB ID: | retro_mdom_881 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:273411836..273412157(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMA16 | ||
Ensembl ID: | ENSMODG00000002170 | ||
Aliases: | None | ||
Description: | translation machinery associated 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:25638] |
Percent Identity: | 59.48 % |
Parental protein coverage: | 56.16 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MPKAPKGKSSGQEKKVIHPYSRKAAQLNREAHKQEKKEKLKNEKALRLNI-IGEKLQWFQSHLDPNKREY |
..K..KGKS.GQEK..I..YSRKAA.......K.EK......E..L.LNI...EK.QWFQSHLDPNK... | |
Retrocopy | LQKLLKGKSTGQEKNIIYSYSRKAAHFKKP*MKKEKLD----ETVLYLNI<QSEKFQWFQSHLDPNK--- |
Parental | SKKDACELIESYLHRFNSELEQIELLNSIKGRQGR-RHFSREAVIK |
.KKD.CEL.ESYL..FNS.LEQIE..NSIKGR.GR.R...RE.VIK | |
Retrocopy | IKKDVCELAESYLYQFNSKLEQIEMHNSIKGRHGR>RLVPRETVIK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006702 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000001119 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000006820 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000009734 | 1 retrocopy | |
Homo sapiens | ENSG00000198498 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025324 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001134 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000004482 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000002170 | 1 retrocopy |
retro_mdom_881 ,
|
Mus musculus | ENSMUSG00000025591 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006466 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000001860 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015167 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000023618 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000014188 | 3 retrocopies | |
Sorex araneus | ENSSARG00000003780 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000024763 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000017224 | 7 retrocopies | |
Tarsius syrichta | ENSTSYG00000008284 | 1 retrocopy |