RetrogeneDB ID: | retro_cpor_444 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_158:862397..862735(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMA16 | ||
| Ensembl ID: | ENSCPOG00000001119 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.42 % |
| Parental protein coverage: | 56.28 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LIHPYSRKAAQIARHAHKLEKKERLKH-EKALRLNLISEKLQWFQNELDPQK-VRYSRKDACQLVERYLN |
| ..H.YSRKAAQI.R.AHK.E.KE.....EK...LNLI..KLQWFQN.L.PQK..RYS.KDACQL.ERYLN | |
| Retrocopy | ILHLYSRKAAQIMREAHKQENKEN*RM>EKTIHLNLIGKKLQWFQNKLEPQK>LRYSKKDACQLTERYLN |
| Parental | RFSSELEQIELLNSIKDRQGRRHHSREMFIKQTIERERQQYEGY |
| .FSSELE.IEL.NSIKDRQGR..H..E..IK.T.ERE.QQY.GY | |
| Retrocopy | GFSSELEWIELHNSIKDRQGRQYHPWETIIKHTMEREQQQYQGY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .58 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .28 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .44 RPM |
| SRP040447_lung | 0 .00 RPM | 5 .85 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 4 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006702 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000001119 | 1 retrocopy |
retro_cpor_444 ,
|
| Dasypus novemcinctus | ENSDNOG00000006820 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009734 | 1 retrocopy | |
| Homo sapiens | ENSG00000198498 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025324 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001134 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000004482 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000002170 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025591 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006466 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000001860 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015167 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000023618 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014188 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000003780 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000024763 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000017224 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008284 | 1 retrocopy |