RetrogeneDB ID: | retro_etel_1378 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_256460:5591..5993(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMA16 | ||
| Ensembl ID: | ENSETEG00000009734 | ||
| Aliases: | None | ||
| Description: | translation machinery associated 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:25638] |
| Percent Identity: | 54.35 % |
| Parental protein coverage: | 67.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | RNEKALRLNIIGEKLQWFQNHLDAKK-EYSKKDACALIESYLNRFSSELEQIELHNSIKDRQGRRHVSRE |
| R..KAL...I.GEKLQ.FQNHLDAKK..YS.K..CA.IESYL...S.EL......NSI.DRQ..RH.S.. | |
| Retrocopy | RIKKALTVHITGEKLQRFQNHLDAKKVDYSEKHTCAFIESYLYQLSHELKE----NSIQDRQAWRHYSQA |
| Parental | MVIKQTMERERQQYEGYGLEIPDIVDAGNLKTFREWDFDLKKLPNIKMRKI-CKNDAIPKKCKKKNVT |
| .V.K...E.E.QQ..GY.LEIPD..DA...K.FRE.D..LK.....K.RKI..KN....K.CK.KN.T | |
| Retrocopy | TVLK*RVEQEGQQFKGYDLEIPDNEDANHMKNFRE*DLNLKD*SHVKIRKIWAKNSILCKNCKRKNAT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006702 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000001119 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006820 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009734 | 1 retrocopy |
retro_etel_1378 ,
|
| Homo sapiens | ENSG00000198498 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025324 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001134 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000004482 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000002170 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025591 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006466 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000001860 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015167 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000023618 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014188 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000003780 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000024763 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000017224 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008284 | 1 retrocopy |