RetrogeneDB ID: | retro_mmul_2392 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 9:35079105..35079276(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000021240 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.18539 | ||
| Ensembl ID: | ENSMMUG00000031677 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 87.72 % |
| Parental protein coverage: | 74.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DWLMGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATI |
| DWL.GK.EVNQETIQRLLEEN.QLI.CIVEYQ.KGR.NECVQ.QHVLHRNLIYLATI | |
| Retrocopy | DWLRGKVEVNQETIQRLLEENEQLILCIVEYQYKGRANECVQCQHVLHRNLIYLATI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 14 .68 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .77 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .53 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .10 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .68 RPM |
| SRP007412_testis | 0 .08 RPM | 8 .90 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_557 |
| Pongo abelii | retro_pabe_513 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
| Homo sapiens | ENSG00000008324 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy |
retro_mmul_2392 ,
|
| Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000013979 | 2 retrocopies |