RetrogeneDB ID: | retro_nleu_2639 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397385.1:4099828..4100020(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SS18L2 | ||
Ensembl ID: | ENSNLEG00000005848 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 90.62 % |
Parental protein coverage: | 83.12 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | DWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTS |
DWLRGK.EVN.ETIQRLLEENDQLIRCIVEYQNKGR.NEC.Q.Q.VLHRNLIYLATIADASPTS | |
Retrocopy | DWLRGKVEVN*ETIQRLLEENDQLIRCIVEYQNKGRANECIQCQLVLHRNLIYLATIADASPTS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
Homo sapiens | ENSG00000008324 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy |
retro_nleu_2639 ,
|
Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000013979 | 2 retrocopies |