RetrogeneDB ID: | retro_mmul_563 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1:177806359..177806701(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ITGB1BP1 | ||
Ensembl ID: | ENSMMUG00000018036 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.32 % |
Parental protein coverage: | 76. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | HSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSE |
HSSSSSQS.EISTKSKSVDSS.GGLS.SS.VASL...STKSSGQSNNNS.TCAEF.IK..GAI..LKLS. | |
Retrocopy | HSSSSSQSGEISTKSKSVDSSIGGLS*SSPVASLNVNSTKSSGQSNNNSNTCAEFQIKCGGAIKILKLSQ |
Parental | GKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVS |
.K.LEG.LDLINYIDVA.QD.KLP.V.PEE.FIMGVSK..I... | |
Retrocopy | RKCLEGLLDLINYIDVAEQDEKLPLVLPEEKFIMGVSKCDISIN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 61 .74 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 48 .63 RPM |
SRP007412_cerebellum | 0 .00 RPM | 52 .50 RPM |
SRP007412_heart | 0 .00 RPM | 24 .85 RPM |
SRP007412_kidney | 0 .00 RPM | 12 .56 RPM |
SRP007412_liver | 0 .00 RPM | 7 .32 RPM |
SRP007412_testis | 0 .00 RPM | 10 .67 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_277 |
Pan troglodytes | retro_ptro_231 |
Gorilla gorilla | retro_ggor_321 |
Pongo abelii | retro_pabe_391 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000013063 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000013602 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000006250 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008930 | 3 retrocopies | |
Homo sapiens | ENSG00000119185 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001754 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006761 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000002359 | 7 retrocopies | |
Myotis lucifugus | ENSMLUG00000010629 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000018036 | 1 retrocopy |
retro_mmul_563 ,
|
Nomascus leucogenys | ENSNLEG00000013322 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000003726 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001679 | 4 retrocopies | |
Procavia capensis | ENSPCAG00000005976 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012667 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011637 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009799 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014537 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000859 | 1 retrocopy |