RetrogeneDB ID: | retro_ptro_231 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:171438486..171438831(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ITGB1BP1 | ||
Ensembl ID: | ENSPTRG00000011637 | ||
Aliases: | None | ||
Description: | integrin beta 1 binding protein 1 [Source:HGNC Symbol;Acc:23927] |
Percent Identity: | 79.13 % |
Parental protein coverage: | 57.5 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | RHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLS |
RH.SSSSQS.EISTKSKSVDSSLGGLS.SS.VASL.TDSTKSS..SNNNS.TCAEF.IKYVGAI..LKLS | |
Retrocopy | RHRSSSSQSGEISTKSKSVDSSLGGLS*SSPVASLNTDSTKSSE*SNNNSNTCAEFQIKYVGAIKTLKLS |
Parental | EGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVS |
E...L.GPLDLINYIDVAQQD.KLP.VP.EE.FIMGVSKY..... | |
Retrocopy | ERRCLKGPLDLINYIDVAQQDEKLPLVPLEEKFIMGVSKYNTSIN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 63 .17 RPM |
SRP007412_cerebellum | 0 .00 RPM | 43 .56 RPM |
SRP007412_heart | 0 .00 RPM | 50 .60 RPM |
SRP007412_kidney | 0 .00 RPM | 27 .41 RPM |
SRP007412_liver | 0 .00 RPM | 18 .40 RPM |
SRP007412_testis | 0 .00 RPM | 11 .07 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_277 |
Gorilla gorilla | retro_ggor_321 |
Pongo abelii | retro_pabe_391 |
Macaca mulatta | retro_mmul_563 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000013063 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000013602 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000006250 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008930 | 3 retrocopies | |
Homo sapiens | ENSG00000119185 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001754 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006761 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000002359 | 7 retrocopies | |
Myotis lucifugus | ENSMLUG00000010629 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000018036 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013322 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000003726 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001679 | 4 retrocopies | |
Procavia capensis | ENSPCAG00000005976 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012667 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011637 | 1 retrocopy |
retro_ptro_231 ,
|
Sorex araneus | ENSSARG00000009799 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014537 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000859 | 1 retrocopy |