RetrogeneDB ID: | retro_mmus_738 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:95176812..95177053(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083548 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl28 | ||
| Ensembl ID: | ENSMUSG00000030432 | ||
| Aliases: | Rpl28, D7Wsu21e | ||
| Description: | ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:101839] |
| Percent Identity: | 86.42 % |
| Parental protein coverage: | 58.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSAHLQWMVVRNCSSFLIKRNKQTYSTEP-NNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVMKRRSG |
| M.AHLQWMVVRNCSSFLIKRNK...STEP..NLKA..SFRYNGLIH.KTVGVEPAAD.KGVVVVMK.RSG | |
| Retrocopy | MAAHLQWMVVRNCSSFLIKRNK*MPSTEP>SNLKACSSFRYNGLIHLKTVGVEPAADDKGVVVVMKCRSG |
| Parental | QRKPATSYVRT |
| QRKPATSYVRT | |
| Retrocopy | QRKPATSYVRT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 32 .57 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 34 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 95 .91 RPM |
| SRP007412_kidney | 0 .02 RPM | 78 .85 RPM |
| SRP007412_liver | 0 .00 RPM | 81 .84 RPM |
| SRP007412_testis | 0 .00 RPM | 58 .32 RPM |