RetrogeneDB ID: | retro_pabe_1869 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 22:14929456..14929671(+) | ||
| Located in intron of: | ENSPPYG00000011571 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000010417 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.6 % |
| Parental protein coverage: | 52.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | RNCSSFLIKRNKQTYSTEPNNLKAR-NSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVR |
| R..SS.LIK.NKQT.STEP.NLKA...SF.YN.LIHR.TVGV.PAADGKGVVVV...RSGQ.KPATSY.. | |
| Retrocopy | RQESSGLIKGNKQTHSTEPENLKAA<SSFHYNELIHRRTVGVDPAADGKGVVVVMEWRSGQQKPATSYEG |
| Parental | TTI |
| TT. | |
| Retrocopy | TTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 60 .32 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 38 .79 RPM |
| SRP007412_heart | 0 .03 RPM | 43 .92 RPM |
| SRP007412_kidney | 0 .03 RPM | 113 .56 RPM |
| SRP007412_liver | 0 .06 RPM | 118 .73 RPM |