RetrogeneDB ID: | retro_pabe_1869 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 22:14929456..14929671(+) | ||
Located in intron of: | ENSPPYG00000011571 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000010417 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.6 % |
Parental protein coverage: | 52.55 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | RNCSSFLIKRNKQTYSTEPNNLKAR-NSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVR |
R..SS.LIK.NKQT.STEP.NLKA...SF.YN.LIHR.TVGV.PAADGKGVVVV...RSGQ.KPATSY.. | |
Retrocopy | RQESSGLIKGNKQTHSTEPENLKAA<SSFHYNELIHRRTVGVDPAADGKGVVVVMEWRSGQQKPATSYEG |
Parental | TTI |
TT. | |
Retrocopy | TTV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 60 .32 RPM |
SRP007412_cerebellum | 0 .00 RPM | 38 .79 RPM |
SRP007412_heart | 0 .03 RPM | 43 .92 RPM |
SRP007412_kidney | 0 .03 RPM | 113 .56 RPM |
SRP007412_liver | 0 .06 RPM | 118 .73 RPM |