RetrogeneDB ID: | retro_ocun_1240 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 4:73338609..73338955(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EEF1B3 | ||
| Ensembl ID: | ENSOCUG00000009848 | ||
| Aliases: | EEF1B3, EEF1B, EF1B | ||
| Description: | eukaryotic translation elongation factor 1 beta 3 (EEF1B3), mRNA [Source:RefSeq mRNA;Acc:NM_001082399] |
| Percent Identity: | 59.17 % |
| Parental protein coverage: | 51.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | VPSQADVAVFEAVSGPPPADLCHALRWYNHIKSYEK-EKASLPG-IKKALGRYGPADVEDTTGSGATDSK |
| V.SQA.V..FEA.S.P.PA.LC..L.W..HIKS.EK.EK...P....KA.G..GPA.VEDTTGSG.T..K | |
| Retrocopy | VLSQACVTMFEAASEPLPATLCQTLCW*SHIKSNEK<EKTGFPE<VRKAQGTQGPAHVEDTTGSGVTVGK |
| Parental | DDDDIDLFGS-DDEEESEEAKRLREERLAQY-ESKKAKKPALVA-KSSIL |
| .D.DI.L.GS...EEE..EAK.LREERL....ESKKA....L.A.KSSIL | |
| Retrocopy | HDNDIELSGSEEEEEENQEAKKLREERLTLL>ESKKAETLVLAA<KSSIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 124 .78 RPM |
| SRP017611_kidney | 0 .00 RPM | 188 .93 RPM |
| SRP017611_liver | 0 .00 RPM | 93 .72 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000029635 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005805 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000014496 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007002 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000002654 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016602 | 8 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000009848 | 4 retrocopies | |
| Oreochromis niloticus | ENSONIG00000017630 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000017163 | 3 retrocopies | |
| Oryzias latipes | ENSORLG00000018533 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013107 | 7 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000017853 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005437 | 3 retrocopies | |
| Xiphophorus maculatus | ENSXMAG00000006050 | 1 retrocopy |