RetrogeneDB ID: | retro_ptro_1763 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 3:24956214..24956619(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF3K | ||
Ensembl ID: | ENSPTRG00000010934 | ||
Aliases: | EIF3K, EIF3S12 | ||
Description: | Eukaryotic translation initiation factor 3 subunit K [Source:UniProtKB/TrEMBL;Acc:H2QG88] |
Percent Identity: | 75.56 % |
Parental protein coverage: | 61.93 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 0 |
Parental | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL |
.AMF...R.NVGKLL..I.RYN.ENLA.L..YVE.QAKENA.DLEA.L.VLKLY.FNPAFFQTTVT.QI. | |
Retrocopy | IAMF**LRVNVGKLLNNIHRYNSENLASLGSYVEIQAKENACDLEASLTVLKLY*FNPAFFQTTVTTQIP |
Parental | LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFE |
LKA.TN..HT.FTLCK.M..Q.HQE...I.QILYLGDLLET.HFQAFWQALDENM.LLEGITGFE | |
Retrocopy | LKAFTNPCHTSFTLCKHMVIQVHQEKQLIQQILYLGDLLET*HFQAFWQALDENMTLLEGITGFE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 76 .43 RPM |
SRP007412_cerebellum | 0 .00 RPM | 52 .70 RPM |
SRP007412_heart | 0 .00 RPM | 40 .43 RPM |
SRP007412_kidney | 0 .03 RPM | 105 .10 RPM |
SRP007412_liver | 0 .03 RPM | 58 .95 RPM |
SRP007412_testis | 0 .00 RPM | 30 .46 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2616 |
Pongo abelii | retro_pabe_2342 |
Macaca mulatta | retro_mmul_1478 |
Macaca mulatta | retro_mmul_1542 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
Homo sapiens | ENSG00000178982 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010217 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000028767 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000010934 | 2 retrocopies |
retro_ptro_1763 , retro_ptro_2176,
|
Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007001 | 1 retrocopy |