RetrogeneDB ID: | retro_ptro_2011 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 4:122779053..122779428(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SAR1A | ||
| Ensembl ID: | ENSPTRG00000002584 | ||
| Aliases: | None | ||
| Description: | SAR1 homolog A (S. cerevisiae) [Source:HGNC Symbol;Acc:10534] |
| Percent Identity: | 84.0 % |
| Parental protein coverage: | 63.13 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNK |
| I.GMTFTTFDLG.HEQA.RVWKN.LPA.NGI.FLVDCADHSRL.ESKVELNALM.DETIS..PILILGNK | |
| Retrocopy | IVGMTFTTFDLGQHEQACRVWKNCLPAMNGIIFLVDCADHSRLIESKVELNALMADETISTMPILILGNK |
| Parental | IDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGF |
| IDRTD.IS.EKL.EIFGLYGQTTGKGNVTLK.LN.RP.EVF.CSVL.RQ.Y.EGF | |
| Retrocopy | IDRTDTISAEKLSEIFGLYGQTTGKGNVTLKQLNVRPVEVFTCSVLQRQTYREGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .44 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 60 .94 RPM |
| SRP007412_heart | 0 .03 RPM | 51 .88 RPM |
| SRP007412_kidney | 0 .00 RPM | 72 .52 RPM |
| SRP007412_liver | 0 .03 RPM | 64 .45 RPM |
| SRP007412_testis | 0 .00 RPM | 52 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2976 |
| Gorilla gorilla | retro_ggor_144 |
| Pongo abelii | retro_pabe_2468 |
| Macaca mulatta | retro_mmul_304 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016353 | 5 retrocopies | |
| Homo sapiens | ENSG00000079332 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024879 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006626 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000011243 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005040 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000002374 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000002584 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000012780 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008657 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005955 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002631 | 2 retrocopies |