RetrogeneDB ID: | retro_ptro_2485 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 6:134818186..134818491(-) | ||
Located in intron of: | ENSPTRG00000018619 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSPE1 | ||
Ensembl ID: | ENSPTRG00000012774 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.87 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK |
.AGQ.FRK.LPLFD.VL.ERSA..TVTKGGIMLPEK...K.LQA..V..G.G.K.K.GEI.P.S..VG.K | |
Retrocopy | LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNK |
Parental | VLLPEYGGTKVVLDDK-DYFLFRDGDILGKYVD |
V.LPEYG.TKVVL.D..DYFLFRDGDILGK.VD | |
Retrocopy | VFLPEYGDTKVVLNDE<DYFLFRDGDILGKSVD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 33 .00 RPM |
SRP007412_cerebellum | 0 .04 RPM | 43 .05 RPM |
SRP007412_heart | 0 .06 RPM | 125 .59 RPM |
SRP007412_kidney | 0 .00 RPM | 129 .40 RPM |
SRP007412_liver | 0 .00 RPM | 156 .86 RPM |
SRP007412_testis | 0 .00 RPM | 45 .63 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3664 |
Gorilla gorilla | retro_ggor_2476 |
Sus scrofa | retro_sscr_106 |
Sus scrofa | retro_sscr_103 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000013246 | 27 retrocopies |
retro_dnov_1088, retro_dnov_1117, retro_dnov_1214, retro_dnov_1375, retro_dnov_1391, retro_dnov_1405, retro_dnov_1412, retro_dnov_1428, retro_dnov_1445, retro_dnov_1546, retro_dnov_1647, retro_dnov_1652, retro_dnov_1686, retro_dnov_1821, retro_dnov_2176, retro_dnov_2291, retro_dnov_2413, retro_dnov_2569, retro_dnov_2625, retro_dnov_2652, retro_dnov_418, retro_dnov_481, retro_dnov_483, retro_dnov_490, retro_dnov_524, retro_dnov_554, retro_dnov_966,
|
Macaca mulatta | ENSMMUG00000010491 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025876 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012774 | 17 retrocopies | |
Sus scrofa | ENSSSCG00000016078 | 7 retrocopies |