RetrogeneDB ID: | retro_shar_500 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL849706.1:1148520..1148776(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSHAG00000014004 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.32 % |
| Parental protein coverage: | 80.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | QKLRNKIAGYVTHLMKRIQRGP-VRGISIKL-QEEERERRDNYVPEVSALDQEIIE-VDPDTKEMLKLLD |
| .K..NK....V.HLMK.IQRGP..R.IS.KL....ER..R....P.VSALDQE.....DPDTKEML.LL. | |
| Retrocopy | KKFVNKNSREVSHLMKYIQRGP>MRSISTKL>KKNER--RGGKCPDVSALDQENTK<IDPDTKEMLQLLE |
| Parental | FGSLSNLQVTQPTVGMNFKTPRGA |
| ....SNLQ.TQP.V..NF..PR.A | |
| Retrocopy | ----SNLQGTQPIVRINFEIPREA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000013053 | 9 retrocopies | |
| Equus caballus | ENSECAG00000024902 | 1 retrocopy | |
| Felis catus | ENSFCAG00000002358 | 7 retrocopies | |
| Homo sapiens | ENSG00000182774 | 11 retrocopies | |
| Homo sapiens | ENSG00000184779 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000031717 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000022830 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000011327 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015571 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006370 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024107 | 16 retrocopies | |
| Pongo abelii | ENSPPYG00000006888 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019106 | 6 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000014004 | 10 retrocopies |
retro_shar_174, retro_shar_203, retro_shar_230, retro_shar_312, retro_shar_326, retro_shar_376, retro_shar_392, retro_shar_500 , retro_shar_647, retro_shar_702,
|
| Sus scrofa | ENSSSCG00000027358 | 2 retrocopies |