RetrogeneDB ID: | retro_btau_1732 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | X:24094115..24094417(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM3 | ||
| Ensembl ID: | ENSBTAG00000007363 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm3 [Source:UniProtKB/Swiss-Prot;Acc:Q32PE9] |
| Percent Identity: | 71.57 % |
| Parental protein coverage: | 99.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETV-TTIEIDEE |
| MAD..D.QQTTNT.EEPLD..RLSLDE.IYVKMRN.REL.GRLHAY.Q.L..ILG..EETV..TIE...E | |
| Retrocopy | MADRMDRQQTTNTIEEPLDHLRLSLDEKIYVKMRNNREL*GRLHAYNQYLSTILGNMEETV<ATIESEGE |
| Parental | TYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRV |
| ...EIYKSTK.NI.MLFV.GDGVVLV.PP..V | |
| Retrocopy | AFQEIYKSTKWNILMLFVWGDGVVLVVPPFTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 20 .69 RPM |
| ERP005899_muscle | 0 .00 RPM | 21 .12 RPM |
| SRP017611_brain | 0 .05 RPM | 6 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .29 RPM |
| SRP030211_testis | 0 .00 RPM | 40 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000007363 | 1 retrocopy |
retro_btau_1732 ,
|
| Callithrix jacchus | ENSCJAG00000016977 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006671 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018032 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000016207 | 8 retrocopies | |
| Homo sapiens | ENSG00000170860 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010006 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000023308 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000023126 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011088 | 1 retrocopy | |
| Oreochromis niloticus | ENSONIG00000000370 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013402 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000014650 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008733 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011601 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011197 | 1 retrocopy |