RetrogeneDB ID: | retro_cfam_1174 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 25:6073287..6073509(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCAFG00000006265 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SHFM1 | ||
Ensembl ID: | ENSCAFG00000002179 | ||
Aliases: | None | ||
Description: | split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845] |
Percent Identity: | 93.24 % |
Parental protein coverage: | 75.51 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | RSVAMSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYK |
.SV.MSEKKQPVDLGLLEEDDEFEEFP.EDWAGLDEDEDAHVWEDNWDDDN.EDDFSNQLRAELEKHGY. | |
Retrocopy | QSVTMSEKKQPVDLGLLEEDDEFEEFPGEDWAGLDEDEDAHVWEDNWDDDNEEDDFSNQLRAELEKHGYM |
Parental | METS |
METS | |
Retrocopy | METS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .34 RPM | 33 .64 RPM |
SRP017611_brain | 0 .16 RPM | 12 .23 RPM |
SRP017611_kidney | 1 .12 RPM | 68 .48 RPM |
SRP017611_liver | 0 .00 RPM | 12 .40 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002179 | 1 retrocopy |
retro_cfam_1174 ,
|
Cavia porcellus | ENSCPOG00000010402 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019778 | 1 retrocopy | |
Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies |