RetrogeneDB ID: | retro_fcat_1138 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C1:158359335..158359545(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000023254 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.43 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS |
MSEKKQ.VDLGL.EED.EF.EFP.EDWAGLDE.E.A.V.E.NWD.DNVE..FSN......E.HGYKMETS | |
Retrocopy | MSEKKQLVDLGLWEEDNEFREFPKEDWAGLDENEEADV*ENNWDFDNVEGNFSNLI*GKSETHGYKMETS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 16 .99 RPM |
SRP017611_kidney | 0 .00 RPM | 37 .20 RPM |
SRP017611_liver | 0 .00 RPM | 16 .88 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010434 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000002179 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010402 | 1 retrocopy | |
Equus caballus | ENSECAG00000018179 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000002237 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000019778 | 1 retrocopy | |
Felis catus | ENSFCAG00000023254 | 2 retrocopies |
retro_fcat_1138 , retro_fcat_121,
|
Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000015337 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000011501 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000016474 | 3 retrocopies |