RetrogeneDB ID: | retro_mluc_948 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL429785:10260888..10261097(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SHFM1 | ||
Ensembl ID: | ENSMLUG00000014208 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 92.96 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MSEKKQPVDLGLLEEDDEFEEFPA-EDWTGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET |
MSEKKQPVDLGLLEEDDEFEEFPA.E..TGLDEDEDAHVWED.WDDDNVEDDFSNQL.AELEKHGYKMET | |
Retrocopy | MSEKKQPVDLGLLEEDDEFEEFPA<EGGTGLDEDEDAHVWEDSWDDDNVEDDFSNQLGAELEKHGYKMET |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010434 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000002179 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010402 | 1 retrocopy | |
Equus caballus | ENSECAG00000018179 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000002237 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000019778 | 1 retrocopy | |
Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy |
retro_mluc_948 ,
|
Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000015337 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000011501 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000016474 | 3 retrocopies |