RetrogeneDB ID: | retro_cfam_700 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 16:27240306..27240543(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LAMTOR3 | ||
Ensembl ID: | ENSCAFG00000029975 | ||
Aliases: | None | ||
Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
Percent Identity: | 82.28 % |
Parental protein coverage: | 63.71 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | RPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELAPLFE |
R.GFLSTFALAT.QGSKLGLSKNKSIICYYNTY.VVQ.N.LPLVVS..A..NA.TGLI.SLEKELAPLFE | |
Retrocopy | RLGFLSTFALATNQGSKLGLSKNKSIICYYNTYHVVQLNNLPLVVSYMARNNASTGLIISLEKELAPLFE |
Parental | ELRQVVEVS |
.LRQ..EVS | |
Retrocopy | KLRQIMEVS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .08 RPM | 20 .54 RPM |
SRP017611_brain | 0 .08 RPM | 20 .88 RPM |
SRP017611_kidney | 0 .13 RPM | 41 .34 RPM |
SRP017611_liver | 0 .00 RPM | 7 .32 RPM |