RetrogeneDB ID: | retro_rnor_2341 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 6:5635765..5635953(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Lamtor3 | ||
Ensembl ID: | ENSRNOG00000010552 | ||
Aliases: | Lamtor3, MP1, Map2k1ip1, Mapksp1 | ||
Description: | Ragulator complex protein LAMTOR3 [Source:UniProtKB/Swiss-Prot;Acc:Q5U204] |
Percent Identity: | 70.31 % |
Parental protein coverage: | 50.81 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MADDLKRFLYKKLPSVEGLHAIVVSDRDGV-PVIKVANDSAPEHALRPGFLSTFALATDQGSKL |
M.DDLKR.LYKKLPS.EGLHAIVV..R.G.....K..NDSAPEHALRPGFLS.F.LAT.Q...L | |
Retrocopy | MVDDLKRSLYKKLPSIEGLHAIVVRERQGA<LLLKWLNDSAPEHALRPGFLSAFSLAT*QDNEL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 17 .18 RPM |
SRP017611_kidney | 0 .00 RPM | 19 .26 RPM |
SRP017611_liver | 0 .00 RPM | 6 .19 RPM |