RetrogeneDB ID: | retro_cjac_2788 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 6:17437492..17437937(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C6orf106 | ||
| Ensembl ID: | ENSCJAG00000015304 | ||
| Aliases: | None | ||
| Description: | chromosome 6 open reading frame 106 [Source:HGNC Symbol;Acc:21215] |
| Percent Identity: | 69.28 % |
| Parental protein coverage: | 50.34 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | PELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMSFVE |
| P...QKF.CLGTTDKDVLISEFQRLL.FQLNPA....FLDMTNWNL.A.IG...DFESPNIS.PSMSFVE | |
| Retrocopy | PGPVQKFGCLGTTDKDVLISEFQRLLSFQLNPADSTSFLDMTNWNLPASIGTSCDFESPNISEPSMSFVE |
| Parental | DVTIGEGESIPPDTQFVKTW-RIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLE-PQEIADVSVQMC |
| DVT.GE.ESI.PDT.FVKTW.R..N.G......G...K.VGGDQF..VNMV.V..LE.P..IA.VSVQMC | |
| Retrocopy | DVTKGEAESISPDT*FVKTW>RSRNLGQRPGFQG--FK*VGGDQFAQVNMVTVSILE>PLNIAEVSVQMC |
| Parental | SPSR-AGMYQGQW |
| S.S..AG..QGQW | |
| Retrocopy | SSSK<AGRNQGQW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 10 .10 RPM |
| SRP051959_heart | 0 .00 RPM | 10 .56 RPM |
| SRP051959_kidney | 0 .00 RPM | 13 .11 RPM |
| SRP051959_liver | 0 .00 RPM | 22 .16 RPM |
| SRP051959_lung | 0 .00 RPM | 14 .30 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 10 .62 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 13 .41 RPM |
| SRP051959_spleen | 0 .00 RPM | 10 .84 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000034493 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015304 | 1 retrocopy |
retro_cjac_2788 ,
|
| Homo sapiens | ENSG00000196821 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000000388 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013442 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022824 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008387 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011264 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009350 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016519 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000018068 | 1 retrocopy |