RetrogeneDB ID: | retro_cpor_1216 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_58:1374514..1374913(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFN1 | ||
Ensembl ID: | ENSCPOG00000013136 | ||
Aliases: | None | ||
Description: | Profilin [Source:UniProtKB/TrEMBL;Acc:H0VN18] |
Percent Identity: | 61.15 % |
Parental protein coverage: | 97.14 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKIFVNITPAEVAVLVGKDRASFF-VNGLTLGGQK |
AG.......L...GTCQD.AIVG.K..PSVW...PGK.FV..TPA..AVLVGKD...F..VNGL.LG.QK | |
Retrocopy | AGLRECQHGLLVGGTCQDPAIVGHKH*PSVWTLEPGKVFVSVTPAKGAVLVGKDWSFFV<VNGLALGDQK |
Parental | CSVIRDSLLQDGEFTMDLRTKSTGGAP-TFNVTVTMTAKTLVLLMGKEGVHGGM-INKKCYEMASHLRR |
C.VI..SLLQ......DL.TKS.GG.P.TF..TV..TA.TLVLLMGKEGV.G....NKKCYE..SHLRR | |
Retrocopy | CRVIQNSLLQN--LPRDLHTKSAGGPP<TFSITVATTAMTLVLLMGKEGVRGVQ<VNKKCYEVDSHLRR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 49 .87 RPM |
SRP017611_kidney | 0 .00 RPM | 144 .15 RPM |
SRP017611_liver | 0 .00 RPM | 144 .47 RPM |
SRP040447_lung | 0 .05 RPM | 441 .64 RPM |
SRP040447_skeletal_muscle | 0 .03 RPM | 101 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy |
retro_cpor_1216 ,
|
Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
Homo sapiens | ENSG00000108518 | 10 retrocopies | |
Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000291 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |