RetrogeneDB ID: | retro_pcap_27 | ||
Retrocopylocation | Organism: | Hyrax (Procavia capensis) | |
Coordinates: | GeneScaffold_1112:126914..127253(-) | ||
Located in intron of: | ENSPCAG00000010423 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFN1 | ||
Ensembl ID: | ENSPCAG00000000291 | ||
Aliases: | None | ||
Description: | profilin 1 [Source:HGNC Symbol;Acc:8881] |
Percent Identity: | 80.53 % |
Parental protein coverage: | 81.75 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AAIVGYKDSPSVWAAVPGKTFVNITPAEVAVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLLDGEYTMDLR |
AAIVGYK.SPSVWA..PGKTF.NI.PA.VAVLVG.DRSS.FV..LTLGGQKCSVI.DSLL.DGEYTMDLR | |
Retrocopy | AAIVGYKESPSVWATIPGKTFINIMPAVVAVLVGRDRSSLFVTRLTLGGQKCSVIWDSLLVDGEYTMDLR |
Parental | TKSTGGAPTFNLTVTMTAKTLV-LMGKEGVHGGLINKKCYEMS |
.KS..GAP.F.LTVT.TAKTLV.LMGKEGVHGGLINKK.Y.M. | |
Retrocopy | LKSSSGAPAFTLTVTTTAKTLVLLMGKEGVHGGLINKKYYKMA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy | |
Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
Homo sapiens | ENSG00000108518 | 10 retrocopies | |
Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000291 | 1 retrocopy |
retro_pcap_27 ,
|
Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |